DPCstruct | MC5244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6ZAZ8 | 6-137 | NVLSVGELQEWLNKKADIEEVKLTDFSDAFAKMLNYNALNCLLNNGAITDSTQLKFRLYHLRNTDQNAPYYNIPDSDSYIYVVFEQE… |
| A0A7X5CYR6 | 77-220 | MTYYEQVKKFKKMIPIGVKSTSELIDFLKSKVDVEEISFDDFPYYNLQMLTNNAVHCIQNMELQIKPEDMLFRIFRVIKNEKSDKYC… |
| A0A316PZ72 | 34-166 | None |
| D4MYG2 | 5-146 | None |
| A0A847CTL5 | 8-158 | None |
| A0A413QH22 | 22-160 | None |
| A0A369AZW4 | 3-144 | None |
| A0A1I4BLW7 | 85-234 | None |
| A6TN44 | 22-207 | None |
| A0A316QIF3 | 13-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.