DPCstruct | MC52436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2F9Y8 | 1-101 | MDQEKFMIIVKGDDKTEDVSSYEMDPPIVKIIYKGSSKAYPYQLNDIQLLTPTVQDITEGMAVFHDEYPFYNVKRVLDFGPKIRVCF… |
| A0A2W4BTU8 | 1-129 | MFSIILDGKDITNKITDWCYMLEKDTVTVTYKSEKKYTASLSRCQITPNIYKKDVVLILDKRTKDEILVENVIEFGNKYLLFTYKSS… |
| F5J3Y1 | 5-113 | None |
| A0A810YGH6 | 1-132 | None |
| A0A8A3SFL0 | 2-162 | None |
| U4SZV5 | 2-160 | None |
| A0A329ZPE0 | 1-105 | None |
| A0A7G6WSI4 | 2-122 | None |
| A0A4R5BUQ0 | 2-112 | None |
| A0A371PN88 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.