DPCstruct | MC52434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 273 ± 37 aa |
| Standard deviation of domain lengths | 36.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 39.79 |
| Pfam Score | 70.28 |
| Assigned Pfam label(s) | PF16543- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6FZC3 | 1-269 | MPPKQQPKADLAKKQKQVEDKTFGLKNKNKSKNVQKYVQSLKQSVQPKPDASKVAAKKKKEEEKAREQELNELFKVAISQPKVPVGV… |
| M7PKZ9 | 1-241 | MPQKKTAPSVKKNPQKIVEDKTFGLKNKNKSSKIQAHIRQIESQAANIGKNKITKEKEMQKKEQTEKKIAEESRKMELSELFKQPPQ… |
| A0A183M3A1 | 1-233 | None |
| R7UEL9 | 10-301 | None |
| A0A2I0HL54 | 1-268 | None |
| A0A162QNH6 | 6-276 | None |
| S6B750 | 14-279 | None |
| A0A0K2VDD7 | 1-209 | None |
| A0A5N5SSY1 | 7-281 | None |
| A0A7V5I9Q8 | 29-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.