DPCstruct | MC52431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9TMJ3 | 161-300 | TPEGMTTMQYGNTWVDLRPLGTEGQGKQNTRPLYGTSALAIPFGIGANFKINERLDLGVEWMARFTSTDYLDDVSRSYVGDVHFGNN… |
| A0A1F3R7Z5 | 72-187 | LGTEGQFISSGNYPDPYKLWQINLPLGFGISYKITKAIEINLDATYHKTFTDYIDDVSGNYPNMVDLANTTNGDLAIILSNRSGVYV… |
| A0A7W1FX56 | 1-128 | None |
| A0A348TT38 | 83-202 | None |
| A0A521V6M9 | 163-267 | None |
| A0A1Q3MWP8 | 113-251 | None |
| A0A344TL64 | 106-219 | None |
| A0A1F3G4B4 | 190-316 | None |
| A0A4Q3QXD4 | 68-173 | None |
| A0A3D2S8X8 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.