DPCstruct | MC52427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9B7T8 | 44-188 | AYRGKDGKVHVAEVKNRGNATTQASLPAQAERLGNWQKAAPGRVARYEIATTKDWQKIFDKFQYKKQTKSQKAANEPKVRPDGTPAS… |
| A0A243S0A4 | 1-125 | MEVKNTGNATIKADFERQVEDLAKWEGKGSAGRATRVEIETTEKWTNIFSGYKSGKRDGVKYKPEGTPAGTMVKNGVSVRIAGTDIS… |
| A0A6G3YTL7 | 95-233 | None |
| A0A542TSJ0 | 758-893 | None |
| A0A6G4XXU9 | 349-481 | None |
| G0XF31 | 1-146 | None |
| A0A2H2XRK8 | 162-298 | None |
| A0A7W5F112 | 276-409 | None |
| A0A3N1U3I2 | 308-456 | None |
| A0A2T0Q362 | 270-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.