DPCstruct | MC5241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1BYP2 | 1-84 | MGMPQIDCMPIKKESALTSLLQSIALQEAALAHILNAEGEKIQRVVCEAKCVDDLLNVNESVTNTIQAVSTLEEMLKDKAIAVI |
| A0A1K1WWW9 | 1-107 | MSQANIPNISPTISINRDNAINLLLASIAMEEIGLSHIINTEGEKIQYVLESLPGVTSPHPPTISDVLLINKSVRDMIRELAKKEWV… |
| A0A1N7BVH7 | 1-92 | None |
| A0A1G6MLG2 | 1-95 | None |
| A0A1V5X954 | 1-119 | None |
| A0A1V9VWE5 | 1-101 | None |
| A0A356B3E8 | 187-281 | None |
| A0A0D0RZE2 | 1-104 | None |
| A0A160FDF1 | 1-104 | None |
| A0A1V5XF21 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.