DPCstruct | MC52406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 72.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9E1U0 | 109-188 | LNLNFHKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNDFFQSFPNCLTYKTSEDFVAKVKEAMT |
| A0A0B2RF46 | 528-599 | GRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYRTSEDFVAKVKEAL |
| A0A834SHV1 | 7-70 | None |
| A0A7J7N9X9 | 146-210 | None |
| A9SV65 | 370-445 | None |
| A0A3L6G8Q2 | 141-236 | None |
| A0A835AI94 | 402-476 | None |
| A0A314V0I1 | 452-523 | None |
| A0A2G2YR51 | 35-103 | None |
| A0A2V0NXZ1 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.