DPCstruct | MC5240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 222 ± 37 aa |
| Standard deviation of domain lengths | 37.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1Z8R4 | 7-229 | ALLFFKIHLKDRSVRLHKDPRIGPEVVGDAYDWGDMHHLHAIVRSPYTKASLLPGVIGSLRIYEITGELTQDAWDYLDFSYDQTMVV… |
| A0A372EUL3 | 2-219 | SKILVGILFKEASLLRDQRQPALGEIFPPDAMDEMFMLHLLLQSWRKLSLFRALHTQHPFTLYVYSLSEDIEYGMFNLSTNIFGPSI… |
| A0A0A7PLZ4 | 1-148 | None |
| A0A839GT49 | 75-325 | None |
| A0A435L8U6 | 79-348 | None |
| A0A2N3F917 | 204-408 | None |
| A0A2V8ANX7 | 8-247 | None |
| A0A090VK89 | 10-298 | None |
| A0A1R1BCA4 | 1-152 | None |
| A0A6P2TZF9 | 44-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.