DPCstruct | MC52388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 78 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180FBP6 | 11-87 | EPVLGDLKESGEIENDADIVLFIHKPDYYDAQAKDKQGVPWKGRGKLIVSKNRQGIRNQTVLFYHDDRYKKVFDYKQ |
| X0XN72 | 1-69 | MVMFVYREEYYLERQKPSEGKVEETLKWQQEMGLVHGKAEVIVGKQRHGPTGSVALTFEAQFTRFSNMA |
| A0A7V7WSC6 | 381-457 | None |
| A0A355TQM5 | 76-158 | None |
| A0A379GC35 | 125-199 | None |
| A0A292RV55 | 1-87 | None |
| A0A3M0CSI6 | 443-553 | None |
| A0A7V3M322 | 14-110 | None |
| G7TJ56 | 124-216 | None |
| A0A3B0PJ66 | 62-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.