DPCstruct | MC52387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180EU85 | 3-96 | YNFPFDYKKCKVISELEFLGKRLSENIFDNAFQKSQKYASTGIRNQLIFKPSLSKSIMDEIDKVLAEHYGFTEEELDFIINYDIKYR… |
| A0A536H0D2 | 217-290 | QTLQKLAIELAQDLQRHSELKLMHYHDLGHLTIQCLFPGKSISIIDEIDRTLAQHYGFTDEELDFLLHFDRQFR |
| A0A1G6YB56 | 22-105 | None |
| A0A2N6QTV3 | 35-123 | None |
| A0A354H4K1 | 10-107 | None |
| A0A3M0XKV8 | 129-208 | None |
| A0A8B5X6F4 | 292-371 | None |
| A0A2H6LAH0 | 2-70 | None |
| I3IL49 | 23-105 | None |
| A0A1W9MLG9 | 5-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.