DPCstruct | MC52382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 337 ± 49 aa |
| Standard deviation of domain lengths | 49.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7PH40 | 26-416 | AAVVLAVGGSLMPSGDIEAFGLKGAGAHTAIDIAPLGVSLAGALLLGMIFARSLRRAGVTIGAGELAARAASVVILFLFLLAGLAWA… |
| A0A4S4CAR3 | 280-579 | LALVIGAVNAIVLALMTTLSGFSAEADLPGRVGSIGIDYSFSFFGALRNGFLLGALFGFAGAMLRLSSFRWARHLHGGIIPYGEPIR… |
| A0A401ZUW7 | 274-609 | None |
| A0A7X1M2R0 | 213-503 | None |
| A0A2M9KZI2 | 111-466 | None |
| A0A150KZL3 | 2-255 | None |
| A0A0N0GYS5 | 90-480 | None |
| A0A430FDV8 | 273-696 | None |
| A0A3N5A2N6 | 107-407 | None |
| A0A7K3EBT0 | 256-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.