DPCstruct | MC52371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 194 ± 34 aa |
| Standard deviation of domain lengths | 33.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8ZPA1 | 29-195 | ADNLPADASGQAHRVCARFALIAAAGELATYYGITGWQPGEAERAAVTCFKAWLEQRGGAGNQERAAILGSVKAFFETHGDARFTDF… |
| A0A503YD65 | 187-420 | KVNKASGVLDTVPDRYENVSEAAAHLRKHCARNYAHPGRIFAARLVEAAAEDEDKLRTQIAKRMSAFLGQLSQRRRTDGTSERVKTI… |
| A0A2H1KZG6 | 159-414 | None |
| Q3ZAC2 | 166-384 | None |
| A0A3C0F714 | 33-270 | None |
| A0A7W1BGD3 | 317-546 | None |
| A0A521TTP4 | 763-994 | None |
| A0A2W5ZG64 | 649-873 | None |
| A0A7U8SVV7 | 12-182 | None |
| A0A7X7XEQ6 | 11-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.