DPCstruct | MC52364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 556 ± 132 aa |
| Standard deviation of domain lengths | 131.73 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 13.44 |
| Pfam Score | 50.72 |
| Assigned Pfam label(s) | CL0464- PF12247- PF12246- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FQC3 | 394-1056 | VKEFFGTLTACAITPFVLIDGSYDESGWKFDTQMKRLKEKMHNALQLSPTTQGKARLLPLLAEMVFVSVLKELSVPFSQTEFEADET… |
| M5BZY0 | 2-647 | EAVQARRDAWNHYEAGRNEQAAKLFESKSTVEQWDLWRPVLRIFRHRNVEFIIAPYSSLAQLVYLQRHPKSYVHALYGPSELLLYAG… |
| K1Q852 | 266-835 | None |
| A0A0R3T8I5 | 1-610 | None |
| A0A813Q7V0 | 91-656 | None |
| A0A0M8N629 | 22-381 | None |
| A0A654HVL1 | 85-785 | None |
| A0A1X7TG61 | 37-468 | None |
| A0A1V6T7N9 | 29-439 | None |
| A0A7R8HDI0 | 3-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.