DPCstruct | MC52362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF09404- PF18755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AJV7 | 2-78 | ILSDSASELTAMEKPFLSFYDKQVDSTYFLARIEPRITLVLIFKYKHSEKEGVIVNFLTEMSLQLRCNRVLATLKNG |
| A0A2G4SMF7 | 247-318 | IIQGSRVRLDDPKAGPIYFFDNVIGSTYYLMRIDRHAVFVIVYLDKHVNREPTTVEFITNIVTSLRGTTVIE |
| A0A444SU75 | 143-229 | None |
| A0A6G0HPR2 | 166-242 | None |
| A0A139WIZ5 | 330-394 | None |
| A0A653CT77 | 205-278 | None |
| L8GUN6 | 278-368 | None |
| A0A3R7MDN7 | 222-298 | None |
| A0A2C9LM90 | 1-77 | None |
| A0A815BY32 | 59-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.