DPCstruct | MC52361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 455 |
|---|---|
| Mean domain length (aa) | 139 ± 26 aa |
| Standard deviation of domain lengths | 25.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.92 |
| Pfam Score | 97.82 |
| Assigned Pfam label(s) | PF00057- CL0692- PF02932- PF02931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5B3Z3 | 1-104 | MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDE… |
| A0A7R9AJ58 | 9-128 | RPNFGREPLYVGFEIAIASFDSISEVDMDMTLTMYLNQYWKDERLEFSTSDEELTLASDFSRRIWVPDIFFPNDKYSYLHDVTEENK… |
| A0A0K0DX41 | 975-1121 | None |
| A0A1I8HZN9 | 336-486 | None |
| A0A1I8IEX4 | 424-570 | None |
| A0A182FWX7 | 671-796 | None |
| A0A399ZJI7 | 445-560 | None |
| A0A1I8IP91 | 581-693 | None |
| A0A2B4S6J6 | 400-512 | None |
| A0A1I8FLR1 | 247-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.