DPCstruct | MC52358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AF08 | 92-190 | EELAAAQVLGEPDIARVPLMIDSSKWEVIEAGLQCIQGKGIVNSISLKEGQDKFIEQAKRIKRYGAATVVMAFDEAGQADTYQRKIE… |
| A0A4Q2WDA7 | 253-342 | APLCIDSTDPKVIEHALKIYHGKAIINSVNGEEHSLETILPLAKKYGAALIALTLDDAGIPPTAVERLAVARKIVERAEAVGIPRED… |
| A0A7S0AFA1 | 272-376 | None |
| A0A7V1D6J3 | 271-357 | None |
| A0A819LUU2 | 199-325 | None |
| A0A800LT92 | 6-108 | None |
| A0A6F9C5Z1 | 342-445 | None |
| A0A376VPX5 | 124-228 | None |
| A0A847WVJ3 | 97-201 | None |
| A0A7J6QE56 | 24-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.