DPCstruct | MC5235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1HWS9 | 408-572 | KDTDATTPLDEYSYTIWLKGGLKFDFSAGVFISSLVDKEYSLQKDTDTNNSNNMIIKQAKKGNFDFGFGTMLNMSLRTAGWIKPSFN… |
| A0A3B7MHA8 | 3-168 | EINYTLTPLKDDGTEDVKKATTKSFTIAKKLGLYPFVSTGVIYTQFSYPEYAIKTDNGVNTVAKTDDVKVNVRPTVFLNLIIASWDP… |
| A0A7T9HJ33 | 65-232 | None |
| W0RPR6 | 241-442 | None |
| A0A532ES83 | 225-391 | None |
| A0A4R1JY02 | 269-443 | None |
| A0A193LHN1 | 16-172 | None |
| A0A7Y3M2H6 | 8-155 | None |
| A0A0J7L9Z5 | 118-279 | None |
| A0A7C1GZH2 | 215-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.