DPCstruct | MC52347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 106 ± 27 aa |
| Standard deviation of domain lengths | 26.88 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850I4B9 | 2-83 | PAIPQGFTDSSWHNDSCPNFTSEELGLRIWVDYADKAQREHPDASRFVLEPSDNEDNITDPICTDDWAVIIEAVEEERAEIV |
| A0A7U0E4S6 | 7-95 | RREFPDYDIATLPTLPEGYVDASSYIDAAPSFENEERGLKVYVDYAEYADRESGRSQRFCVSRYDEEAGDYEDVALSTNDWAEVIRF… |
| A0A0R3MNF6 | 2-79 | None |
| A0A841GGS1 | 9-107 | None |
| A0A0N1EPQ7 | 4-138 | None |
| A0A2G1LLX3 | 4-143 | None |
| A0A7R7TAH4 | 96-186 | None |
| A0A0X6ZW10 | 6-167 | None |
| A2SNH5 | 7-105 | None |
| A0A160FXL2 | 54-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.