DPCstruct | MC52342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8VKH6 | 7-123 | IGEDSSVFRVAFHYVSSDRNPFADVSDDVTADELRALIQRLQKMGSRGRSGSWAAPTLTLINANPIVASSQLAPTAGMETKTFKANV… |
| A0A510V2W3 | 80-165 | ADTSFTADQRAQLAATLARWDARSPWTRQTLELIRDRPATRAPDLAASVGRETAPFKRDVRRLKELGLTHSLEVGYRLSPRGQAYL |
| A0A849ZJC3 | 104-202 | None |
| A0A7Y9LIL1 | 1-108 | None |
| A0A222TER6 | 37-147 | None |
| F4CZH8 | 50-140 | None |
| A0A7W7CQC2 | 227-320 | None |
| A0A7G7LDZ4 | 98-196 | None |
| I5BRN6 | 1-101 | None |
| A0A7C2SCE0 | 149-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.