DPCstruct | MC5234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316VMQ0 | 12-98 | LPPKIATPKSVQGPAGGDSTRMESVVEFYKSLPKGEANAKRGGGIKGRFFDGKNASGKPIVWTIGTLLLLGYSLEYQHLKHHKNYEH |
| A0A3M2SY06 | 13-102 | IPPKIASPNAIGAAQDAARMDRVVNFYAKLPRGAAPEAKPTGLLERYQARYFTGKNASAAPIAQIIAGILLLSYGMEYYFHLRHHKN… |
| A0A2S4V3P6 | 5-88 | None |
| A0A1C7ML35 | 14-99 | None |
| A0A4Y9ZN79 | 391-476 | None |
| A0A4T0LH86 | 14-95 | None |
| A0A5C2T601 | 14-90 | None |
| S8DSD4 | 14-87 | None |
| A0A4S4LBS5 | 1-78 | None |
| A0A4U0UI77 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.