DPCstruct | MC52335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 165 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094IJL3 | 3-177 | GSGVGLKITKKEKEILPLIRTNTEIINKHYNSIPKNKRTEHTTLEFSPDNTIVKIIIGDSKMGWATSLRYFFELLTANHFADISTII… |
| A0A1G7X0D7 | 124-304 | FYDFLDLFYLLMVGTGVGIRILKEDAEKFETYRADHELLALHYTPKKKSDRLELSVLEVGDTTATIYVGDSKEGFVGSLKLYFDLII… |
| A0A2H0RB03 | 82-240 | None |
| H8FYB5 | 496-668 | None |
| A0A7X7BAQ7 | 101-264 | None |
| A0A6C0JMX5 | 24-181 | None |
| A0A2K3AT16 | 102-289 | None |
| A0A0H5PSA4 | 2-173 | None |
| A0A0G0TXD2 | 226-375 | None |
| A0A8A3LUK8 | 175-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.