DPCstruct | MC52326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 60.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0MHW1 | 38-109 | MSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSIPG |
| A0A445B8P9 | 1-78 | MFRAQNSVLKYMVKIMKVCTARGFVYSIVPEKGKPVTDSSDSLREWWKEDIRFDQNSPSAIAKYLPLISLSSSRDEEN |
| F6HA32 | 102-169 | None |
| A0A6P5RL40 | 38-105 | None |
| A0A0B0MZA8 | 81-163 | None |
| A9SK60 | 69-137 | None |
| A0A7J8NCD7 | 1-70 | None |
| A0A3P6BJA4 | 55-126 | None |
| A0A6J5WPG8 | 13-79 | None |
| A0A6J5V8L8 | 12-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.