DPCstruct | MC52325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 69.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2EC68 | 274-366 | AVTSLGSTLAIKLLSTKRVDDARYGVYSHRLDDKWLVGGASNTGGAILRQLFSDEHLERLSQEINPMVASPLDYYPLQSSGERFPIA… |
| A0A0N7KNB0 | 154-235 | KAVTSLGSTLAIKLLSNARVDDARFGVYSHRLDDMWLVGGASNTGGAVLRQLFTDDQLVALSHEIDPSVPSLLDYYPLPKRG |
| A0A2N9G486 | 259-336 | None |
| A0A835IVW8 | 33-137 | None |
| A0A103XSB7 | 263-343 | None |
| A0A812YZ91 | 154-257 | None |
| A0A4D9CXF7 | 307-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.