DPCstruct | MC52321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L0F5 | 218-312 | CSVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNYCGNAIPDGMVKNQKLPANILTPTTKAADHDVPITPDEIVKSGLMSKDDFDEARS… |
| J6F825 | 373-463 | AIVRGYITGSAWSEYKKSQTVHGIPMPAGLVESQKLPKAIFTPSTKADLGDHDENIHPDKVKDICGPELAAEIERVALALYNEAAAY… |
| A0A813KB80 | 68-160 | None |
| A0A445AXJ0 | 1-105 | None |
| A0A0B3AHJ6 | 109-189 | None |
| A0A1U8FP48 | 48-126 | None |
| A0A519TM89 | 93-187 | None |
| A0A2K3L0Q5 | 181-278 | None |
| A0A800AXR7 | 21-109 | None |
| A0A7J6MKL9 | 114-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.