DPCstruct | MC5232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9KII2 | 166-253 | WTRPTLTPAPTHFAALQDVGAVPYLNEAGRRGYQQFLTIRKPRAFVIAPDGGWNAVSLGIDPVAVALQTCSRSHQGCRLYTVDNDVVW |
| A0A2W6W1K4 | 12-105 | CIAALLPCTVHAAEPTAWLRPVDLIEAVPLLNEGGRAGYGRFLQVTLRPRAFALNMNGDWAWNAGDNAADEAVAACEAQGLPCQLYA… |
| A0A254T8F7 | 167-250 | None |
| A0A7Y7WLY4 | 428-520 | None |
| A0A257SS83 | 377-463 | None |
| A0A561JVG8 | 167-256 | None |
| A0A2T7UAK1 | 471-561 | None |
| A0A7C3L435 | 1-99 | None |
| A0A6L3SZU5 | 190-275 | None |
| A0A7W9WQS6 | 346-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.