DPCstruct | MC52311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7BGJ0 | 79-155 | RPLLEELFLHYFRIPEEEEGCEPLSAPEILMTISKQSKIDLTETKLRLFGQLMQKYNVRKKMKKDRKYYYVIPETEE |
| D4VNM0 | 299-371 | VPPEEQLFFRYFRAAQPEEGEWLSPAEIMEDIQKGSSIPMSVKRVNSFGRILKKQEIPSKHTRSGTLYHVVRL |
| A0A7K1M0J4 | 40-126 | None |
| A0A6I1RPM4 | 101-187 | None |
| R7E4A9 | 1-87 | None |
| A0A415GDB9 | 63-150 | None |
| A0A415DNB2 | 8-84 | None |
| A0A1H4FA92 | 103-186 | None |
| A0A414ZF01 | 118-193 | None |
| A0A5C6JH04 | 149-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.