DPCstruct | MC5230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3K014 | 1-82 | MDKDIDGKDAKIKSTEESSLSFLCVPPIGMEFLVPKTGFFCKACNRFYSGTNEAEINHCRTEKHYMNLQVGINLIEFTYQQQ |
| A0A0E9Q3Z0 | 3-75 | DKEEKVEQKSDQVPVPLGPYQPNNPVGIDYIVQRTGFFCKLCKVFYTSEKTAKSLHCSSLAHYQKLKMKLAED |
| A0A668T5G5 | 67-158 | None |
| A0A3P9JHW5 | 202-289 | None |
| A0A3Q4HIR2 | 111-182 | None |
| A0A3B3HCK0 | 213-288 | None |
| A0A402G539 | 64-154 | None |
| G3PVI5 | 151-239 | None |
| A0A6I9PDB2 | 7-84 | None |
| A0A667W8W1 | 6-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.