DPCstruct | MC523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8F9D8 | 1-78 | MAKEYDTFVDDITTIKEGQEITIAVRETDIYRTRVVIAVVSSSRENLPDGDILLMRYNRGNLRPDPWYIKINSDVPGL |
| A0A1J4S7D0 | 1-79 | MKKDYEFFARFADSIPEGTEVKFMVRDSSNYQYIPIKGKIFKNPDQAPQGSHNLWWRNPLGIKANTPWGLQIIEECDDM |
| E1YIW3 | 2-84 | None |
| A0A7V2VST0 | 3-77 | None |
| A0A2A5NZ32 | 6-87 | None |
| A0A5P9P217 | 1-78 | None |
| A0A1G1EH14 | 1-87 | None |
| A0A1G1EDD3 | 1-91 | None |
| A0A523BSZ0 | 16-97 | None |
| A0A1J4S9V7 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.