DPCstruct | MC52295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 111 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 95.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2HVF6 | 1-113 | MLQPNVLNDVDGRYLGSDWQIHRLAPGQRAQYGTFSGWDQYRAHIQLLALLKPEIAGDFAQSMHQFAQQNQGIWDRWLHNNGPTHVM… |
| A0A6I3RKG2 | 71-182 | TFYTSAYHAALHPFIFQDADGQFRGLDKNIEKAEGFTNYTVFSLWDTYRALHPWFNLVQQEVNANIANSMLAHYDKSVEKMLPIWSF… |
| A0A1V3WPM5 | 98-205 | None |
| A0A1V3WYL2 | 98-206 | None |
| A0A0P0M0Y3 | 47-159 | None |
| A0A255ZSH1 | 15-123 | None |
| A0A5M3MT55 | 107-213 | None |
| A0A090WXR0 | 101-212 | None |
| A0A3P0XFY5 | 311-418 | None |
| A0A1H1A055 | 41-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.