DPCstruct | MC5229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 221 ± 49 aa |
| Standard deviation of domain lengths | 48.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5VYS5 | 131-376 | LCPAPAYTGLLFRRTDLDGFEIPASPQYVARVSYATALVRAGVMVATVEHLLAALYACGVDNAIIEMDNLEVPILDGSAAPFVQMLA… |
| A0A1F6EXM6 | 10-239 | PLSSMHLETRGILHSLVLRCQGFALRIPEHLLGLIFALGLDGVLIAPENFRLPYNGTAEPYWNAVEPAHRDAGNLTWYTPPESFEVV… |
| A0A3N5KD77 | 40-278 | None |
| A0A7V0YUW7 | 15-237 | None |
| A0A7X6ZIF0 | 12-182 | None |
| A0A5J4YHS9 | 104-363 | None |
| A0A7V5K1W1 | 1-146 | None |
| K8EEM8 | 249-460 | None |
| A0A199VX95 | 2-206 | None |
| A0A4Y9JCL8 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.