DPCstruct | MC52285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 162 ± 32 aa |
| Standard deviation of domain lengths | 31.82 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G6RI82 | 23-167 | GNTNDDLSKINKSILIPYDIISNVFLYPVNETIFEKSYLKSKYYTGYKIKISNSIWILCYLHHFDLHSEELIWTIYDSKSKQVKSNL… |
| A0A7Y7CUX0 | 40-193 | FENYISTLDQIPLPLEANPLGQLPETSKNFDKSAFEKYKHTWTSHPLDIYYQDDKTIGIIDCSIGDWGIVPFLTTYDLEGNKIDSTG… |
| A1ZSI1 | 6-229 | None |
| A1ZE14 | 47-253 | None |
| A0A2G2KDD6 | 277-447 | None |
| A0A3G2GA30 | 106-227 | None |
| A0A1M5MHC5 | 5-106 | None |
| A0A4Q4KEG8 | 81-293 | None |
| A0A7C3YW79 | 15-207 | None |
| A0A7C4JX80 | 3-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.