DPCstruct | MC52280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2ID38 | 4-169 | SPAERKRQERRCPGPRGDERMNRALIAREANPELPLLDALLDGGFIFPGLGIEKNDKLVRDADGVTLYQRKNQLMRRQREARKRNSK… |
| A0A7R9W1A2 | 105-214 | SGVSGKVLNSKKKGKRWRDPRMTRAVQAKVESPKMSLLDALISGGYDYQRTKPNRHTDKDIRDSEGVLLYQRKNHLCRRLRDMRNCE… |
| A0A7S1ZCV9 | 1-194 | None |
| A0A7S2UR93 | 36-185 | None |
| A0A7S4QML0 | 1-183 | None |
| A0A7S2GYE2 | 5-221 | None |
| A0A6U3TSX2 | 66-181 | None |
| A0A7R9Z8X8 | 4-204 | None |
| A0A7R9ZAD1 | 98-272 | None |
| A0A7R9Z5V8 | 20-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.