DPCstruct | MC5228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 193 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3RP51 | 5-211 | LAAASAALAIGVVSQAAAATATSYDATSHQRSASDNHSLWLRGFENVVGTAPSNHRFDFLPDGTFVQNGDGTASLSGSVTSQSEAGS… |
| A0A352WPC0 | 207-386 | LNVGTTADGIGPDGAIRVFGLTALGLANSDYFVESYPLLVSRYANGLAVVTGQVENTMNPSLKWNVHLVLEDPLMGDEWLAQDPSHG… |
| A0A5C6V4U8 | 518-699 | None |
| A0A518BLG1 | 175-327 | None |
| A0A6P0KG63 | 4-211 | None |
| A0A6L9ZWK4 | 3-247 | None |
| Q54EQ7 | 219-397 | None |
| Q54GU7 | 87-296 | None |
| P54704 | 11-205 | None |
| D3BPN2 | 21-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.