DPCstruct | MC52275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 769 |
|---|---|
| Mean domain length (aa) | 75 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 99.38 |
| Assigned Pfam label(s) | CL0229- CL0128- CL0417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SYK7 | 262-342 | RISRDICELREENRGLKTELEGLEAQVRCRICYESRRNCLLMPCLHHLFCTRCIDLHFQSSGARTCPVCRKGVSGVLVTQL |
| A0A7S2HP66 | 128-205 | PCPAAPMRGGGNIRPQNVYKELENMKRENTCKICLDEQINSVFIPCGHLACCMGCAGQLPSKECPVCRASIVSVVETF |
| A0A1Q9CFD7 | 297-349 | None |
| A0A7M5UTY2 | 972-1050 | None |
| A0A6P8GZX4 | 573-639 | None |
| A0A7S3ZJQ7 | 318-369 | None |
| A0A4Z2HR22 | 45-90 | None |
| F4PU31 | 794-880 | None |
| F4PSW7 | 837-905 | None |
| A0A821GXN7 | 65-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.