DPCstruct | MC52270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7I1B7 | 1-88 | MINLDGLENIVQIDDFLGISSNKSLVEINGLNNLSTLNGKLIISHNLALNNFCGIKPLIDNGFSNSFDIASNSFNPTQQDILNGNCSE |
| A0A1G7EK28 | 318-402 | DGLSNLGSIYGFVTISQNDSLTDINGLTNLTLLEQELTINSNATLTDLCGLQNLLTNGGLSGDYTVVNNAYNPTEQDIIDGNCSI |
| A0A2G2Q861 | 1-108 | None |
| A0A2E2W8V8 | 185-266 | None |
| A0A2E2W8U5 | 343-420 | None |
| A0A330MR73 | 1-70 | None |
| A0A4V5Q0F4 | 57-155 | None |
| A0A099XMK4 | 245-329 | None |
| A0A3M0GI05 | 633-720 | None |
| A0A2N1FAM9 | 275-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.