DPCstruct | MC5227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2G330 | 3-138 | SPLGDLNLVKADIPAVLAAARQAPYAAPADRSCTALAEHIQALDTVLGADLDTPSTDRNPSLIERGAGAAKKGAIGAVKGAAEGIVP… |
| A0A7Y3RJM7 | 18-190 | TRPHDADQGMTGGITEGVLAPLTDLNMRKEAIPPILTALAVYEKPVPESCAGIEIEIADLESYVGSDVDTLQTASADGLVSFSGLSN… |
| A0A1M3IA27 | 15-148 | None |
| A0A219B8G9 | 1-128 | None |
| A0A2G2GME3 | 3-188 | None |
| B4W891 | 63-208 | None |
| A0A841MC29 | 1-141 | None |
| A0A840I092 | 26-175 | None |
| A0A7X1KME7 | 27-172 | None |
| A0A399RIV8 | 16-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.