DPCstruct | MC52266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 420 ± 55 aa |
| Standard deviation of domain lengths | 54.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5JLU7 | 48-423 | NMKEVLFYLFTCLLIFLAISWRKQIPRGEKIFLLSVYFVFLFVSFKTGFTRHSGHAFIPGTSILLAALFLLFILNSWVNYLLIFVSL… |
| A0A098TMB5 | 2-376 | LSAFIVYLYIKLTVEKNIILYSQFQELEQLFTQILLTCVFAFLLFKASSVRWHSLWQYRLKMISILTIYLYLQLALSTTSILYIQLS… |
| A0A1H9FGJ9 | 447-883 | None |
| A0A1V9V7N2 | 205-651 | None |
| A0A4P5TRE1 | 309-814 | None |
| A0A2V8K327 | 1-404 | None |
| A0A1Q3NKW4 | 33-450 | None |
| A0A0S4UC66 | 4-396 | None |
| E1RBT6 | 344-782 | None |
| A0A378INX3 | 196-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.