DPCstruct | MC52265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 145 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 18.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TLA1 | 2-160 | TNSLHHAFRRNLNRVLARSLVVGAIVTAGILGGIVPSWTGTSYKLALSSLAAAQTFSDSEITNYARAVLAIEPVRQAAFNEIKRTVS… |
| A0A426KEV5 | 1-140 | MRNLIIIAFISLSTISWSQKENFSAQTLEKFANAYKEVRNENMTFQLNMVSAIEDAGLTNDEFTDIHELINNPNAEKKPTTAQKRQY… |
| A0A845X960 | 1-127 | None |
| A0A1G9J564 | 1-156 | None |
| A0A098TMZ1 | 15-138 | None |
| A0A6P0TBF8 | 1-182 | None |
| A0A2A6M718 | 29-167 | None |
| A0A556A7P3 | 109-244 | None |
| D7G4P7 | 46-199 | None |
| A0A1I7HTU7 | 4-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.