DPCstruct | MC52264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TKL3 | 19-94 | IPLLQTQEVKRCHIYLPETPRPMGAVFYRGQFYSYVRFFPSVEGMERAALRLRERSHTVLVTSSTKGFVLWAMEPE |
| A0A7Y3X8U9 | 12-91 | LESAPRMIQEQQITPFKFYMDQSMQYGVTYGKELYRLARQFAVSDRLEAYRYGCELLEQGIPTLISASKQRYIVWTSLRS |
| A0A0M1JSX5 | 1-79 | None |
| U5DND5 | 2-82 | None |
| A0A832H5Z8 | 1-70 | None |
| A0A563VRG4 | 1-103 | None |
| A0A251WB18 | 134-213 | None |
| A0A1Z4JKD9 | 101-181 | None |
| A0A845X3L6 | 3-88 | None |
| A0A6M8B5E4 | 15-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.