DPCstruct | MC52261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 303 |
|---|---|
| Mean domain length (aa) | 213 ± 59 aa |
| Standard deviation of domain lengths | 58.67 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 97.53 |
| Assigned Pfam label(s) | CL0238- PF13475- CL0063- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3LL38 | 104-350 | EAVKRNGLALKAVKEETEEICSLAVKQNGDALKYVKKQTEVVCKEAVKQSYEALQYVKKQTEEICIEAVKQNYKALQYVKKQTEAVC… |
| D2VMK6 | 36-246 | KLWNYKPVVKRIAEVCGYRVLESASEELRNDREVALAIVKNEGLSLKFLPEQFKSDREIVLHAVKSHAHALKFVTDHALRNDREIIL… |
| A0A450Z8U2 | 5-171 | None |
| A0A4P5SIB1 | 51-246 | None |
| T0EB76 | 3-121 | None |
| A0A381KPT6 | 12-171 | None |
| A0A381I511 | 30-203 | None |
| A0A381I4V7 | 3-134 | None |
| A0A378I1D1 | 21-238 | None |
| A0A0X8JJQ9 | 24-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.