DPCstruct | MC5226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6WYJ9 | 1-84 | MSAAATEGSAVKAAVQGPAVKGPASYFPSIEKKYGRPVEEWVALIRESELSRHMELVAWLKSEHGLGHGHANALVAHTLAGGSK |
| A0A6J7DQF4 | 26-92 | TEKKVTGPASYFPSIEKKYGKPIEHWMKELKKVSKLAHMEQVAHLKEKFEMGHGHANAIVAVFRQKN |
| A0A7G6AC45 | 1-68 | None |
| V4NPG0 | 59-134 | None |
| A0A8A3TD88 | 84-159 | None |
| A0A5C6TN09 | 1-70 | None |
| A0A3N0GS25 | 2-76 | None |
| A0A3D2VLE2 | 3-65 | None |
| A0A7X0LPT9 | 130-204 | None |
| Q0C3F3 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.