DPCstruct | MC52250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9I9X5 | 4-107 | SKVNKMVIVAMLAAISFVLIFIDFPILPGFSFLKIDFADVPVLIGTVLFGPVWGMATAGLAGLLDIIVRDSNPAGALGAVANWMAAV… |
| A0A091BZA5 | 3-97 | SNARKMVAVAMFAAMGLVLQYIAFPVMPAFGFLKIDFSDVPVILSMFLFGPISGVLTAFLRSFLHLITTGLAPQNIVGDVASFLATT… |
| A0A2N6QWU5 | 2-109 | None |
| A0A7J0B2G3 | 49-142 | None |
| A0A7U9AIC3 | 20-113 | None |
| A0A7U1LPH9 | 67-164 | None |
| A0A3D3FGA4 | 18-110 | None |
| J1P177 | 3-97 | None |
| A0A7D7G2U6 | 1-110 | None |
| A0A3B8KB10 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.