DPCstruct | MC52249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF14073- PF06657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672YXR0 | 1-196 | MYLPQSTSPSHSVHANVQSILHMMKHHQPQLCERVSALHRSGCTAKKSLQKDFCPSSIAFQKPHSEEEEEQSVGSLSDLLLALQDEL… |
| A0A7J8GWX0 | 4-174 | LEAKLREEERERKRMQAKAAELQTGLETNRLIFENKAIPCVPSAKRIKKKKSKPPEKVSSRSGKSKKSETPTSSSSINEELSEVLQT… |
| Q28BZ7 | 275-415 | None |
| G5APJ7 | 1-176 | None |
| A0A674H983 | 466-636 | None |
| F7IHU2 | 189-363 | None |
| A0A814B2Z1 | 176-345 | None |
| L5LPA4 | 129-288 | None |
| A0A7J8EQ27 | 263-406 | None |
| A0A3N0Z8D2 | 128-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.