DPCstruct | MC52247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 233 ± 39 aa |
| Standard deviation of domain lengths | 39.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672YNG9 | 1-264 | MSAQKDCEFLVKRARELVSEDPCAAKAWLITARTLYPADFNIQYEMYIIERNAERTASAGRLLYDMFINFPDQPIVWREISVITAAL… |
| A0A6P5J2S3 | 42-238 | MSSLGDCEFLVQRARELVQQDLWAAKAWLITARSLYPADFNIQYEMYIIERNAERTASAGRLLYDMFVNFPDQPVVWREISVITSAL… |
| H2Y978 | 1-206 | None |
| T1FS75 | 706-989 | None |
| J9ATB0 | 92-365 | None |
| A0A482V0B0 | 7-197 | None |
| A0A7R9KPN7 | 925-1160 | None |
| A0A7R8CHC3 | 10-198 | None |
| A0A7J7ZI36 | 1-182 | None |
| A0A653DRC0 | 1-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.