DPCstruct | MC52246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 192 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0028- PF15432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2CTQ7 | 1-209 | MSFQNHRMQGQLPLLKEDTEYQIMTDLSVVPENSVFFKIEIFDTAGLLIDEQYLTLRGGVFKYPKNAKSYFLRLITTTSKVVHFRWI… |
| A0A7Z0LGL4 | 208-412 | IYKNSPIELWPEYKKQGNVEIQMVVKTIVDGSLSTIDKEWIFSEEDLKDAVILDTDIKGYISVSIFVKGDGVLELGPIHYRFSRLGF… |
| S4DDM1 | 153-351 | None |
| A0A4Q9ZGV2 | 295-495 | None |
| A0A837RM44 | 1-189 | None |
| U4TM82 | 1-168 | None |
| A0A4Q1B978 | 88-264 | None |
| A0A0Z8EBT7 | 48-247 | None |
| W9EJ86 | 51-226 | None |
| A0A2V1MY04 | 50-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.