DPCstruct | MC52237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 279 ± 41 aa |
| Standard deviation of domain lengths | 41.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814M7G8 | 1-241 | MKNKKEQEATAKPKFLTKQEREATTLQRRQEEVEAVRQHNEEMLKKHDTFSKEAQRTVVKDDQGRDRYRHEKVDHRDRSSSSRADEE… |
| A0A820YYN0 | 77-275 | GTTTTKRVPLSLEEMLEKNKKEQEAIAKPKFITKEEREAAALRRRQEEADAIRQRNDELRKKYSSFNKEAEQTAAKEDRERERKERD… |
| A0A4D9BB41 | 1-291 | None |
| B4G8Z2 | 127-385 | None |
| A0A182IEJ5 | 128-435 | None |
| A0A7S1P1V2 | 1-283 | None |
| A0A2C6A4B9 | 1-280 | None |
| A0A023FJR8 | 102-401 | None |
| A0A182DZL9 | 213-597 | None |
| A9RII2 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.