DPCstruct | MC52229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 138 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8CR00 | 2-134 | IKRTGELTLTILGMVIALMVFAFGIFAKTLKNTQELQDLIKQSNATNNASITADDMVQAVHMLGTSLILSGIIGFIIALVASFFIKG… |
| A0A2N6SFW9 | 4-150 | FKRTVEKVLSWIANVFLILFTGALWYMHSRDIMHDQGFVVKFKEELAKRPNTNIGYTADELINQMALGLKYYTVFYIVLTIIAIIAT… |
| A0A1M5KWZ6 | 1-137 | None |
| A0A853V0Q9 | 2-139 | None |
| A0A7W8CU32 | 7-145 | None |
| A0A380F7D2 | 1-119 | None |
| A0A7M2WHR3 | 18-150 | None |
| A0A239ZNL2 | 10-145 | None |
| A0A428N9E3 | 16-153 | None |
| A0A7Y8QFB3 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.