DPCstruct | MC52225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803LYJ5 | 1-73 | MGTSTGVSEVKVEDYVFPATVKAPGSDNSFFLAGAGNDSFFNNIGVRGIEIQGNFVKFTAIGVYLEETAISTF |
| A0A5N6PSN3 | 1-64 | MANLQSSTGLQVESIVFAPAVKPPGATTTFFLAGAGVRGMEIHGNFVKFTGIGVYLENKAVSVL |
| A0A6A1W1J4 | 137-204 | None |
| A0A1U8ACU7 | 1-62 | None |
| A0A4Y1R1J3 | 1-63 | None |
| A0A4U5R5E9 | 1-62 | None |
| A0A6S7LC55 | 1-63 | None |
| A0A5C7GY44 | 1-72 | None |
| A0A7J0GVH5 | 1-73 | None |
| A0A445F9Q9 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.