DPCstruct | MC52224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 289 ± 65 aa |
| Standard deviation of domain lengths | 65.43 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.91 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0540- PF19340- PF00183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SU19 | 33-195 | SLSRILETFAKLATKLNRFRRVVMATQSPGGERVSQTQEAFADSLNCYLLSVDEALQKIEKKVSEKREFISLLNLSNQLNSLNLQVS… |
| A0A803LM24 | 161-439 | GWSGGVLVLSKDPDNIRDIAFREFANLLKEENDVSEEVLVRDVLNASQGIDGSYVKYDGNIDGYALSDSIKVPRATRIMIQKLCELG… |
| A0A4S4D1C6 | 37-345 | None |
| A0A2R6QJ39 | 5-394 | None |
| A0A4T0JEJ7 | 546-848 | None |
| A0A7J0EKA0 | 7-252 | None |
| A0A7D8YUS8 | 385-733 | None |
| A0A7T8KCV4 | 12-244 | None |
| A0A1Y1NDD1 | 1-177 | None |
| A0A446TW92 | 16-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.