DPCstruct | MC52223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 385 ± 80 aa |
| Standard deviation of domain lengths | 79.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.87 |
| Pfam Score | 94.43 |
| Assigned Pfam label(s) | PF04046- PF04037- CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803LLD4 | 8-371 | TGVDSAAAATVLEEVEVTYVPEKADLDDDLLDDFKRVFEKFSFKEPEGDEADEKKDEIDQDAAAKKKADSDSDEEDQDNQLKEKGIS… |
| T0MEE9 | 1-278 | MNSDYSFIYKNKSLNKKERKKVIRQKKYEELKKIVPFPELLDIEDLKCEDIIKYNKLKSMYKGVHVIKRWKHKNIFPLNYKQKEYEI… |
| Q4UC05 | 58-534 | None |
| R1BL73 | 2-375 | None |
| A0A3M7LYC0 | 391-851 | None |
| A0A2P8Y8K8 | 254-669 | None |
| A0A232FBW1 | 35-565 | None |
| R0KXW2 | 14-248 | None |
| A0A7S4KHB4 | 10-355 | None |
| A0A0B2UIV7 | 21-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.